Anti-HDAC5
Catalog Number:
ATA-HPA030991
- Images (9)
| Article Name: | Anti-HDAC5 |
| Biozol Catalog Number: | ATA-HPA030991 |
| Supplier Catalog Number: | HPA030991 |
| Alternative Catalog Number: | ATA-HPA030991-100,ATA-HPA030991-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ90614, KIAA0600, NY-CO-9 |
| histone deacetylase 5 |
| Anti-HDAC5 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 10014 |
| UniProt: | Q9UQL6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | THPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HDAC5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles, cytosol & the Golgi apparatus. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity and strong nuclear positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human cerebellum shows weak cytoplasmic positivity and moderate nuclear positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic and nuclear positivity in myocytes. |
|
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity and strong nuclear positivity in trophoblastic cells. |
|
|
HPA030991-100ul |
|
|
|
|
|
HPA030991-100ul |
|
|
HPA030991-100ul |
Product Guarantee and Expert Support
