Anti-GPT

Artikelnummer: ATA-HPA031060
Artikelname: Anti-GPT
Artikelnummer: ATA-HPA031060
Hersteller Artikelnummer: HPA031060
Alternativnummer: ATA-HPA031060-100,ATA-HPA031060-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ALT1, GPT1
glutamic-pyruvate transaminase (alanine aminotransferase)
Anti-GPT
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 2875
UniProt: P24298
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: FRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GPT
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human liver and tonsil tissues using Anti-GPT antibody. Corresponding GPT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, kidney, liver and tonsil using Anti-GPT antibody HPA031060 (A) shows similar protein distribution across tissues to independent antibody HPA031059 (B).
Immunohistochemical staining of human tonsil shows low expression as expected.
Immunohistochemical staining of human liver shows high expression.
Immunohistochemical staining of human kidney using Anti-GPT antibody HPA031060.
Immunohistochemical staining of human colon using Anti-GPT antibody HPA031060.
HPA031060-100ul
HPA031060-100ul
HPA031060-100ul