Anti-GPT Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA031060
- Bilder (9)
| Artikelname: | Anti-GPT Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA031060 |
| Hersteller Artikelnummer: | HPA031060 |
| Alternativnummer: | ATA-HPA031060-100,ATA-HPA031060-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ALT1, GPT1 |
| glutamic-pyruvate transaminase (alanine aminotransferase) |
| Anti-GPT |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2875 |
| UniProt: | P24298 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GPT |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human liver and tonsil tissues using Anti-GPT antibody. Corresponding GPT RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, kidney, liver and tonsil using Anti-GPT antibody HPA031060 (A) shows similar protein distribution across tissues to independent antibody HPA031059 (B). |
|
|
Immunohistochemical staining of human tonsil shows low expression as expected. |
|
|
Immunohistochemical staining of human liver shows high expression. |
|
|
Immunohistochemical staining of human kidney using Anti-GPT antibody HPA031060. |
|
|
Immunohistochemical staining of human colon using Anti-GPT antibody HPA031060. |
|
|
HPA031060 |
|
|
HPA031060 |
|
|
HPA031060 |
Produktgarantie und fachkundiger Support
