Anti-GPT
Catalog Number:
ATA-HPA031060
- Images (9)
| Article Name: | Anti-GPT |
| Biozol Catalog Number: | ATA-HPA031060 |
| Supplier Catalog Number: | HPA031060 |
| Alternative Catalog Number: | ATA-HPA031060-100,ATA-HPA031060-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ALT1, GPT1 |
| glutamic-pyruvate transaminase (alanine aminotransferase) |
| Anti-GPT |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 2875 |
| UniProt: | P24298 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GPT |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human liver and tonsil tissues using Anti-GPT antibody. Corresponding GPT RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, kidney, liver and tonsil using Anti-GPT antibody HPA031060 (A) shows similar protein distribution across tissues to independent antibody HPA031059 (B). |
|
|
Immunohistochemical staining of human tonsil shows low expression as expected. |
|
|
Immunohistochemical staining of human liver shows high expression. |
|
|
Immunohistochemical staining of human kidney using Anti-GPT antibody HPA031060. |
|
|
Immunohistochemical staining of human colon using Anti-GPT antibody HPA031060. |
|
|
HPA031060 |
|
|
HPA031060 |
|
|
HPA031060 |
Product Guarantee and Expert Support
