Anti-GPT

Catalog Number: ATA-HPA031060
Article Name: Anti-GPT
Biozol Catalog Number: ATA-HPA031060
Supplier Catalog Number: HPA031060
Alternative Catalog Number: ATA-HPA031060-100,ATA-HPA031060-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ALT1, GPT1
glutamic-pyruvate transaminase (alanine aminotransferase)
Anti-GPT
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 2875
UniProt: P24298
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GPT
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human liver and tonsil tissues using Anti-GPT antibody. Corresponding GPT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, kidney, liver and tonsil using Anti-GPT antibody HPA031060 (A) shows similar protein distribution across tissues to independent antibody HPA031059 (B).
Immunohistochemical staining of human tonsil shows low expression as expected.
Immunohistochemical staining of human liver shows high expression.
Immunohistochemical staining of human kidney using Anti-GPT antibody HPA031060.
Immunohistochemical staining of human colon using Anti-GPT antibody HPA031060.
HPA031060-100ul
HPA031060-100ul
HPA031060-100ul