Anti-FKBP5
Artikelnummer:
ATA-HPA031092
- Bilder (8)
| Artikelname: | Anti-FKBP5 |
| Artikelnummer: | ATA-HPA031092 |
| Hersteller Artikelnummer: | HPA031092 |
| Alternativnummer: | ATA-HPA031092-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FKBP51, FKBP54, P54, PPIase, Ptg-10 |
| FK506 binding protein 5 |
| Anti-FKBP5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2289 |
| UniProt: | Q13451 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FKBP5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human breast and cerebral cortex tissues using Anti-FKBP5 antibody. Corresponding FKBP5 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Immunohistochemical staining of human breast shows high expression. |
|
|
Western blot analysis using Anti-FKBP5 antibody HPA031092 (A) shows similar pattern to independent antibody HPA031093 (B). |
|
|
HPA031092-100ul |
|
|
|
|
|
HPA031092-100ul |
|
|
HPA031092-100ul |
Produktgarantie und fachkundiger Support
