Anti-FKBP5 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA031092
- Images (8)
| Article Name: | Anti-FKBP5 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA031092 |
| Supplier Catalog Number: | HPA031092 |
| Alternative Catalog Number: | ATA-HPA031092-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FKBP51, FKBP54, P54, PPIase, Ptg-10 |
| FK506 binding protein 5 |
| Anti-FKBP5 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 2289 |
| UniProt: | Q13451 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FKBP5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human breast and cerebral cortex tissues using Anti-FKBP5 antibody. Corresponding FKBP5 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Immunohistochemical staining of human breast shows high expression. |
|
|
Western blot analysis using Anti-FKBP5 antibody HPA031092 (A) shows similar pattern to independent antibody HPA031093 (B). |
|
|
HPA031092 |
|
|
|
|
|
HPA031092 |
|
|
HPA031092 |
Product Guarantee and Expert Support
