Anti-OFD1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA031103
| Artikelname: |
Anti-OFD1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA031103 |
| Hersteller Artikelnummer: |
HPA031103 |
| Alternativnummer: |
ATA-HPA031103-100, ATA-HPA031103-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
71-7A, CXorf5, JBTS10, RP23 |
| Klonalität: |
Polyclonal |
| NCBI: |
8481 |
| UniProt: |
O75665 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
LLKEEKLELLAQNKLLKQQLEESRNENLRLLNRLAQPAPELAVFQKELRKAEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQILGYKA |
| Target-Kategorie: |
OFD1 |