Anti-OFD1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA031103
- Images (0)
| Article Name: | Anti-OFD1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA031103 |
| Supplier Catalog Number: | HPA031103 |
| Alternative Catalog Number: | ATA-HPA031103-100, ATA-HPA031103-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | 71-7A, CXorf5, JBTS10, RP23 |
| Clonality: | Polyclonal |
| NCBI: | 8481 |
| UniProt: | O75665 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LLKEEKLELLAQNKLLKQQLEESRNENLRLLNRLAQPAPELAVFQKELRKAEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQILGYKA |
| Target: | OFD1 |
Product Guarantee and Expert Support
