Anti-LGALS4
Artikelnummer:
ATA-HPA031185
- Bilder (9)
| Artikelname: | Anti-LGALS4 |
| Artikelnummer: | ATA-HPA031185 |
| Hersteller Artikelnummer: | HPA031185 |
| Alternativnummer: | ATA-HPA031185-100,ATA-HPA031185-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GAL4 |
| lectin, galactoside-binding, soluble, 4 |
| Anti-LGALS4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3960 |
| UniProt: | P56470 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LGALS4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human colon and liver tissues using Anti-LGALS4 antibody. Corresponding LGALS4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, kidney, liver and rectum using Anti-LGALS4 antibody HPA031185 (A) shows similar protein distribution across tissues to independent antibody HPA031184 (B). |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human colon shows high expression. |
|
|
Immunohistochemical staining of human kidney using Anti-LGALS4 antibody HPA031185. |
|
|
Immunohistochemical staining of human rectum using Anti-LGALS4 antibody HPA031185. |
|
|
HPA031185-100ul |
|
|
HPA031185-100ul |
|
|
HPA031185-100ul |
Produktgarantie und fachkundiger Support
