Anti-LGALS4

Catalog Number: ATA-HPA031185
Article Name: Anti-LGALS4
Biozol Catalog Number: ATA-HPA031185
Supplier Catalog Number: HPA031185
Alternative Catalog Number: ATA-HPA031185-100,ATA-HPA031185-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GAL4
lectin, galactoside-binding, soluble, 4
Anti-LGALS4
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 3960
UniProt: P56470
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LGALS4
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human colon and liver tissues using Anti-LGALS4 antibody. Corresponding LGALS4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon, kidney, liver and rectum using Anti-LGALS4 antibody HPA031185 (A) shows similar protein distribution across tissues to independent antibody HPA031184 (B).
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human colon shows high expression.
Immunohistochemical staining of human kidney using Anti-LGALS4 antibody HPA031185.
Immunohistochemical staining of human rectum using Anti-LGALS4 antibody HPA031185.
HPA031185-100ul
HPA031185-100ul
HPA031185-100ul