Anti-TBXAS1
Artikelnummer:
ATA-HPA031258
- Bilder (9)
| Artikelname: | Anti-TBXAS1 |
| Artikelnummer: | ATA-HPA031258 |
| Hersteller Artikelnummer: | HPA031258 |
| Alternativnummer: | ATA-HPA031258-100,ATA-HPA031258-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CYP5, CYP5A1, THAS, TS, TXAS, TXS |
| thromboxane A synthase 1 (platelet) |
| Anti-TBXAS1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6916 |
| UniProt: | P24557 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TBXAS1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human spleen and skin tissues using Anti-TBXAS1 antibody. Corresponding TBXAS1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, liver, skin and spleen using Anti-TBXAS1 antibody HPA031258 (A) shows similar protein distribution across tissues to independent antibody HPA031259 (B). |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
Immunohistochemical staining of human spleen shows high expression. |
|
|
Immunohistochemical staining of human liver using Anti-TBXAS1 antibody HPA031258. |
|
|
Immunohistochemical staining of human colon using Anti-TBXAS1 antibody HPA031258. |
|
|
HPA031258-100ul |
|
|
HPA031258-100ul |
|
|
HPA031258-100ul |
Produktgarantie und fachkundiger Support
