Anti-TBXAS1
Catalog Number:
ATA-HPA031258
- Images (9)
| Article Name: | Anti-TBXAS1 |
| Biozol Catalog Number: | ATA-HPA031258 |
| Supplier Catalog Number: | HPA031258 |
| Alternative Catalog Number: | ATA-HPA031258-100,ATA-HPA031258-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CYP5, CYP5A1, THAS, TS, TXAS, TXS |
| thromboxane A synthase 1 (platelet) |
| Anti-TBXAS1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 6916 |
| UniProt: | P24557 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEVLGQRIPAGAVLEMAVGALHHDPEH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TBXAS1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human spleen and skin tissues using Anti-TBXAS1 antibody. Corresponding TBXAS1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, liver, skin and spleen using Anti-TBXAS1 antibody HPA031258 (A) shows similar protein distribution across tissues to independent antibody HPA031259 (B). |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
Immunohistochemical staining of human spleen shows high expression. |
|
|
Immunohistochemical staining of human liver using Anti-TBXAS1 antibody HPA031258. |
|
|
Immunohistochemical staining of human colon using Anti-TBXAS1 antibody HPA031258. |
|
|
HPA031258-100ul |
|
|
HPA031258-100ul |
|
|
HPA031258-100ul |
Product Guarantee and Expert Support
