Anti-C1orf87

Artikelnummer: ATA-HPA031368
Artikelname: Anti-C1orf87
Artikelnummer: ATA-HPA031368
Hersteller Artikelnummer: HPA031368
Alternativnummer: ATA-HPA031368-100,ATA-HPA031368-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CREF, MGC34837
chromosome 1 open reading frame 87
Anti-C1orf87
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 127795
UniProt: Q8N0U7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LLTGANSSRFLDGNIPSQANVHCSSVPTGDQSLSYVHGIPRRKLRDWSLEQMVRGSSDQPEDIGQSPSGTTNEDAFLLALVRRELKSRP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: C1orf87
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of human fallopian tube, kidney, lymph node and testis using Anti-C1orf87 antibody HPA031368 (A) shows similar protein distribution across tissues to independent antibody HPA031366 (B).
Immunohistochemical staining of human lymph node using Anti-C1orf87 antibody HPA031368.
Immunohistochemical staining of human fallopian tube using Anti-C1orf87 antibody HPA031368.
Immunohistochemical staining of human kidney using Anti-C1orf87 antibody HPA031368.
Immunohistochemical staining of human testis using Anti-C1orf87 antibody HPA031368.
HPA031368-100ul
HPA031368-100ul
HPA031368-100ul