Anti-C1orf87 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-C1orf87 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA031368
• Supplier Catalog Number: HPA031368
• Alternative Catalog Number: ATA-HPA031368-100,ATA-HPA031368-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CREF, MGC34837

Product Description

chromosome 1 open reading frame 87

Additional Information

Anti-C1orf87

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 127795
• UniProt: Q8N0U7
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LLTGANSSRFLDGNIPSQANVHCSSVPTGDQSLSYVHGIPRRKLRDWSLEQMVRGSSDQPEDIGQSPSGTTNEDAFLLALVRRELKSRP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: C1orf87
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemical staining of human fallopian tube, kidney, lymph node and testis using Anti-C1orf87 antibody HPA031368 (A) shows similar protein distribution across tissues to independent antibody HPA031366 (B).

Immunohistochemical staining of human lymph node using Anti-C1orf87 antibody HPA031368.

Immunohistochemical staining of human fallopian tube using Anti-C1orf87 antibody HPA031368.

Immunohistochemical staining of human kidney using Anti-C1orf87 antibody HPA031368.

Immunohistochemical staining of human testis using Anti-C1orf87 antibody HPA031368.

HPA031368

HPA031368

HPA031368