Anti-SPATA20 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031442
Artikelname: Anti-SPATA20 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031442
Hersteller Artikelnummer: HPA031442
Alternativnummer: ATA-HPA031442-100,ATA-HPA031442-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ21347, SSP411, Tisp78
spermatogenesis associated 20
Anti-SPATA20
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 64847
UniProt: Q8TB22
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LAAWNGLMVSGYAVTGAVLGQDRLINYATNGAKFLKRHMFDVASGRLMRTCYTGPGGTVEHSNPPCWGFLEDYAFVVRGLLDLYE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SPATA20
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of human cerebral cortex, kidney, lymph node and testis using Anti-SPATA20 antibody HPA031442 (A) shows similar protein distribution across tissues to independent antibody HPA027144 (B).
Immunohistochemical staining of human testis using Anti-SPATA20 antibody HPA031442.
Immunohistochemical staining of human cerebral cortex using Anti-SPATA20 antibody HPA031442.
Immunohistochemical staining of human kidney using Anti-SPATA20 antibody HPA031442.
Immunohistochemical staining of human lymph node using Anti-SPATA20 antibody HPA031442.
HPA031442
HPA031442
HPA031442