Anti-SPATA20

Catalog Number: ATA-HPA031442
Article Name: Anti-SPATA20
Biozol Catalog Number: ATA-HPA031442
Supplier Catalog Number: HPA031442
Alternative Catalog Number: ATA-HPA031442-100,ATA-HPA031442-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ21347, SSP411, Tisp78
spermatogenesis associated 20
Anti-SPATA20
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 64847
UniProt: Q8TB22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LAAWNGLMVSGYAVTGAVLGQDRLINYATNGAKFLKRHMFDVASGRLMRTCYTGPGGTVEHSNPPCWGFLEDYAFVVRGLLDLYE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SPATA20
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500
Immunohistochemical staining of human cerebral cortex, kidney, lymph node and testis using Anti-SPATA20 antibody HPA031442 (A) shows similar protein distribution across tissues to independent antibody HPA027144 (B).
Immunohistochemical staining of human testis using Anti-SPATA20 antibody HPA031442.
Immunohistochemical staining of human cerebral cortex using Anti-SPATA20 antibody HPA031442.
Immunohistochemical staining of human kidney using Anti-SPATA20 antibody HPA031442.
Immunohistochemical staining of human lymph node using Anti-SPATA20 antibody HPA031442.
HPA031442-100ul
HPA031442-100ul
HPA031442-100ul