Anti-SPATA20 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SPATA20 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA031442
• Supplier Catalog Number: HPA031442
• Alternative Catalog Number: ATA-HPA031442-100,ATA-HPA031442-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ21347, SSP411, Tisp78

Product Description

spermatogenesis associated 20

Additional Information

Anti-SPATA20

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 64847
• UniProt: Q8TB22
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LAAWNGLMVSGYAVTGAVLGQDRLINYATNGAKFLKRHMFDVASGRLMRTCYTGPGGTVEHSNPPCWGFLEDYAFVVRGLLDLYE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SPATA20
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500

Images

Immunohistochemical staining of human cerebral cortex, kidney, lymph node and testis using Anti-SPATA20 antibody HPA031442 (A) shows similar protein distribution across tissues to independent antibody HPA027144 (B).

Immunohistochemical staining of human testis using Anti-SPATA20 antibody HPA031442.

Immunohistochemical staining of human cerebral cortex using Anti-SPATA20 antibody HPA031442.

Immunohistochemical staining of human kidney using Anti-SPATA20 antibody HPA031442.

Immunohistochemical staining of human lymph node using Anti-SPATA20 antibody HPA031442.

HPA031442

HPA031442

HPA031442