Anti-HLA-E Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031454
Artikelname: Anti-HLA-E Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031454
Hersteller Artikelnummer: HPA031454
Alternativnummer: ATA-HPA031454-100,ATA-HPA031454-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HLA-E
major histocompatibility complex, class I, E
Anti-HLA-E
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 3133
UniProt: None
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HLA-E
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry analysis in human spleen and pancreas tissues using Anti-HLA-E antibody. Corresponding HLA-E RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human spleen shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA031454
HPA031454
HPA031454