Anti-HLA-E

Catalog Number: ATA-HPA031454
Article Name: Anti-HLA-E
Biozol Catalog Number: ATA-HPA031454
Supplier Catalog Number: HPA031454
Alternative Catalog Number: ATA-HPA031454-100,ATA-HPA031454-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HLA-E
major histocompatibility complex, class I, E
Anti-HLA-E
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 3133
UniProt: None
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HLA-E
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry analysis in human spleen and pancreas tissues using Anti-HLA-E antibody. Corresponding HLA-E RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human spleen shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA031454-100ul
HPA031454-100ul
HPA031454-100ul