Anti-HRNR
Artikelnummer:
ATA-HPA031469
- Bilder (9)
| Artikelname: | Anti-HRNR |
| Artikelnummer: | ATA-HPA031469 |
| Hersteller Artikelnummer: | HPA031469 |
| Alternativnummer: | ATA-HPA031469-100,ATA-HPA031469-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLG3, S100A16, S100a18 |
| hornerin |
Anti-HRNR |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 388697 |
| UniProt: | Q86YZ3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HRNR |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. |
|
|
Immunohistochemical staining of human skin shows moderate to strong cytoplasmic granular positivity in the cornified layer. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
Immunohistochemical staining of human testis shows weak positivity in peritubular myoid cells. |
|
|
HPA031469-100ul |
|
|
|
|
|
HPA031469-100ul |
|
|
HPA031469-100ul |
Produktgarantie und fachkundiger Support
