Anti-HRNR

Catalog Number: ATA-HPA031469
Article Name: Anti-HRNR
Biozol Catalog Number: ATA-HPA031469
Supplier Catalog Number: HPA031469
Alternative Catalog Number: ATA-HPA031469-100,ATA-HPA031469-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLG3, S100A16, S100a18
hornerin

Anti-HRNR

Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 388697
UniProt: Q86YZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HRNR
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human skin shows moderate to strong cytoplasmic granular positivity in the cornified layer.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemical staining of human testis shows weak positivity in peritubular myoid cells.
HPA031469-100ul
HPA031469-100ul
HPA031469-100ul