Anti-DCDC2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031582
Artikelname: Anti-DCDC2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031582
Hersteller Artikelnummer: HPA031582
Alternativnummer: ATA-HPA031582-100,ATA-HPA031582-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DCDC2A, KIAA1154, RU2
doublecortin domain containing 2
Anti-DCDC2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 51473
UniProt: Q9UHG0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEIVDEEEDGEKANKDAEQKEDFSGMNGDL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DCDC2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line RPTEC TERT1 shows localization to cytosol & mitotic spindle.
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-DCDC2 antibody. Corresponding DCDC2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA031582
HPA031582
HPA031582