Anti-DCDC2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-DCDC2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA031582
• Supplier Catalog Number: HPA031582
• Alternative Catalog Number: ATA-HPA031582-100,ATA-HPA031582-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: DCDC2A, KIAA1154, RU2

Product Description

doublecortin domain containing 2

Additional Information

Anti-DCDC2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 51473
• UniProt: Q9UHG0
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEIVDEEEDGEKANKDAEQKEDFSGMNGDL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: DCDC2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line RPTEC TERT1 shows localization to cytosol & mitotic spindle.

Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-DCDC2 antibody. Corresponding DCDC2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human fallopian tube shows high expression.

Immunohistochemical staining of human prostate shows low expression as expected.

HPA031582

HPA031582

HPA031582