Anti-DCDC2

Catalog Number: ATA-HPA031582
Article Name: Anti-DCDC2
Biozol Catalog Number: ATA-HPA031582
Supplier Catalog Number: HPA031582
Alternative Catalog Number: ATA-HPA031582-100,ATA-HPA031582-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DCDC2A, KIAA1154, RU2
doublecortin domain containing 2
Anti-DCDC2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 51473
UniProt: Q9UHG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LTKLKQNVKLKNSQETIPNSDEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEIVDEEEDGEKANKDAEQKEDFSGMNGDL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DCDC2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line RPTEC TERT1 shows localization to cytosol & mitotic spindle.
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-DCDC2 antibody. Corresponding DCDC2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA031582
HPA031582
HPA031582