Anti-ASCC3 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031610
Artikelname: Anti-ASCC3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031610
Hersteller Artikelnummer: HPA031610
Alternativnummer: ATA-HPA031610-100,ATA-HPA031610-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ASC1p200, dJ121G13.4, dJ467N11.1, HELIC1, RNAH
activating signal cointegrator 1 complex subunit 3
Anti-ASCC3
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 10973
UniProt: Q8N3C0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QLNNMDEVCYENVLKQVKAGHQVMVFVHARNATVRTAMSLIERAKNCGHIPFFFPTQGHDYVLAEKQVQRSRNKQVRELFPDGFSIHHAG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ASCC3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-ASCC3 antibody HPA031610 (A) shows similar protein distribution across tissues to independent antibody HPA031608 (B).
Immunohistochemical staining of human testis using Anti-ASCC3 antibody HPA031610.
Immunohistochemical staining of human cerebral cortex using Anti-ASCC3 antibody HPA031610.
Immunohistochemical staining of human colon using Anti-ASCC3 antibody HPA031610.
Immunohistochemical staining of human lymph node using Anti-ASCC3 antibody HPA031610.
HPA031610
HPA031610
HPA031610