Anti-ASCC3
Catalog Number:
ATA-HPA031610
- Images (8)
| Article Name: | Anti-ASCC3 |
| Biozol Catalog Number: | ATA-HPA031610 |
| Supplier Catalog Number: | HPA031610 |
| Alternative Catalog Number: | ATA-HPA031610-100,ATA-HPA031610-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ASC1p200, dJ121G13.4, dJ467N11.1, HELIC1, RNAH |
| activating signal cointegrator 1 complex subunit 3 |
| Anti-ASCC3 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 10973 |
| UniProt: | Q8N3C0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QLNNMDEVCYENVLKQVKAGHQVMVFVHARNATVRTAMSLIERAKNCGHIPFFFPTQGHDYVLAEKQVQRSRNKQVRELFPDGFSIHHAG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ASCC3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-ASCC3 antibody HPA031610 (A) shows similar protein distribution across tissues to independent antibody HPA031608 (B). |
|
|
Immunohistochemical staining of human testis using Anti-ASCC3 antibody HPA031610. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-ASCC3 antibody HPA031610. |
|
|
Immunohistochemical staining of human colon using Anti-ASCC3 antibody HPA031610. |
|
|
Immunohistochemical staining of human lymph node using Anti-ASCC3 antibody HPA031610. |
|
|
HPA031610 |
|
|
HPA031610 |
|
|
HPA031610 |
Product Guarantee and Expert Support
