Anti-ASCC3

Catalog Number: ATA-HPA031610
Article Name: Anti-ASCC3
Biozol Catalog Number: ATA-HPA031610
Supplier Catalog Number: HPA031610
Alternative Catalog Number: ATA-HPA031610-100,ATA-HPA031610-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ASC1p200, dJ121G13.4, dJ467N11.1, HELIC1, RNAH
activating signal cointegrator 1 complex subunit 3
Anti-ASCC3
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 10973
UniProt: Q8N3C0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QLNNMDEVCYENVLKQVKAGHQVMVFVHARNATVRTAMSLIERAKNCGHIPFFFPTQGHDYVLAEKQVQRSRNKQVRELFPDGFSIHHAG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ASCC3
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-ASCC3 antibody HPA031610 (A) shows similar protein distribution across tissues to independent antibody HPA031608 (B).
Immunohistochemical staining of human testis using Anti-ASCC3 antibody HPA031610.
Immunohistochemical staining of human cerebral cortex using Anti-ASCC3 antibody HPA031610.
Immunohistochemical staining of human colon using Anti-ASCC3 antibody HPA031610.
Immunohistochemical staining of human lymph node using Anti-ASCC3 antibody HPA031610.
HPA031610
HPA031610
HPA031610