Anti-ASCC3 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ASCC3 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA031610
• Supplier Catalog Number: HPA031610
• Alternative Catalog Number: ATA-HPA031610-100,ATA-HPA031610-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ASC1p200, dJ121G13.4, dJ467N11.1, HELIC1, RNAH

Product Description

activating signal cointegrator 1 complex subunit 3

Additional Information

Anti-ASCC3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 10973
• UniProt: Q8N3C0
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: QLNNMDEVCYENVLKQVKAGHQVMVFVHARNATVRTAMSLIERAKNCGHIPFFFPTQGHDYVLAEKQVQRSRNKQVRELFPDGFSIHHAG
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ASCC3
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50

Images

Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-ASCC3 antibody HPA031610 (A) shows similar protein distribution across tissues to independent antibody HPA031608 (B).

Immunohistochemical staining of human testis using Anti-ASCC3 antibody HPA031610.

Immunohistochemical staining of human cerebral cortex using Anti-ASCC3 antibody HPA031610.

Immunohistochemical staining of human colon using Anti-ASCC3 antibody HPA031610.

Immunohistochemical staining of human lymph node using Anti-ASCC3 antibody HPA031610.

HPA031610

HPA031610

HPA031610