Anti-MUC17 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031634
Artikelname: Anti-MUC17 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031634
Hersteller Artikelnummer: HPA031634
Alternativnummer: ATA-HPA031634-100,ATA-HPA031634-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MUC17
mucin 17, cell surface associated
Anti-MUC17
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 140453
UniProt: Q685J3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NPTSTPTVPRTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MUC17
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human small intestine and fallopian tube tissues using HPA031634 antibody. Corresponding MUC17 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon shows weak cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human duodenum shows moderate membranous positivity in glandular cells.
Immunohistochemical staining of human small intestine shows moderate membranous positivity in glandular cells.
Immunohistochemical staining of human fallopian tube shows no positivity in glandular cells as expected.
HPA031634
HPA031634
HPA031634