Anti-MUC17

Catalog Number: ATA-HPA031634
Article Name: Anti-MUC17
Biozol Catalog Number: ATA-HPA031634
Supplier Catalog Number: HPA031634
Alternative Catalog Number: ATA-HPA031634-100,ATA-HPA031634-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MUC17
mucin 17, cell surface associated
Anti-MUC17
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 140453
UniProt: Q685J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NPTSTPTVPRTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MUC17
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human small intestine and fallopian tube tissues using HPA031634 antibody. Corresponding MUC17 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human colon shows weak cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human duodenum shows moderate membranous positivity in glandular cells.
Immunohistochemical staining of human small intestine shows moderate membranous positivity in glandular cells.
Immunohistochemical staining of human fallopian tube shows no positivity in glandular cells as expected.
HPA031634
HPA031634
HPA031634