Anti-RSPH9
Artikelnummer:
ATA-HPA031703
- Bilder (7)
| Artikelname: | Anti-RSPH9 |
| Artikelnummer: | ATA-HPA031703 |
| Hersteller Artikelnummer: | HPA031703 |
| Alternativnummer: | ATA-HPA031703-100,ATA-HPA031703-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C6orf206, CILD12, FLJ30845, MRPS18AL1 |
| radial spoke head 9 homolog (Chlamydomonas) |
| Anti-RSPH9 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 221421 |
| UniProt: | Q9H1X1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RSPH9 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human fallopian tube and pancreas tissues using HPA031703 antibody. Corresponding RSPH9 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells. |
|
|
HPA031703-100ul |
|
|
HPA031703-100ul |
|
|
HPA031703-100ul |
Produktgarantie und fachkundiger Support
