Anti-RSPH9
Catalog Number:
ATA-HPA031703
- Images (7)
| Article Name: | Anti-RSPH9 |
| Biozol Catalog Number: | ATA-HPA031703 |
| Supplier Catalog Number: | HPA031703 |
| Alternative Catalog Number: | ATA-HPA031703-100,ATA-HPA031703-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C6orf206, CILD12, FLJ30845, MRPS18AL1 |
| radial spoke head 9 homolog (Chlamydomonas) |
| Anti-RSPH9 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 221421 |
| UniProt: | Q9H1X1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RSPH9 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human fallopian tube and pancreas tissues using HPA031703 antibody. Corresponding RSPH9 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells. |
|
|
HPA031703-100ul |
|
|
HPA031703-100ul |
|
|
HPA031703-100ul |
Product Guarantee and Expert Support
