Anti-PERM1
Artikelnummer:
ATA-HPA031712
- Bilder (7)
| Artikelname: | Anti-PERM1 |
| Artikelnummer: | ATA-HPA031712 |
| Hersteller Artikelnummer: | HPA031712 |
| Alternativnummer: | ATA-HPA031712-100,ATA-HPA031712-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C1orf170, MGC13275, Perm1, RP11-54O7.8 |
| PPARGC1 and ESRR induced regulator, muscle 1 |
| Anti-PERM1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 84808 |
| UniProt: | Q5SV97 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PVQEDRPGPGLGLSTPVPVTEQGTDQIRTPRRAKLHTVSTTVWEALPDVSRAKSDMAVSTPASEPQPDRDMAVSTPASEPQSDRDMAVSTPASEPQPD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PERM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human skeletal muscle and pancreas tissues using HPA031712 antibody. Corresponding PERM1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human pancreas shows no positivity as expected. |
|
|
HPA031712-100ul |
|
|
HPA031712-100ul |
|
|
HPA031712-100ul |
Produktgarantie und fachkundiger Support
