Anti-PERM1
Catalog Number:
ATA-HPA031712
- Images (7)
| Article Name: | Anti-PERM1 |
| Biozol Catalog Number: | ATA-HPA031712 |
| Supplier Catalog Number: | HPA031712 |
| Alternative Catalog Number: | ATA-HPA031712-100,ATA-HPA031712-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C1orf170, MGC13275, Perm1, RP11-54O7.8 |
| PPARGC1 and ESRR induced regulator, muscle 1 |
| Anti-PERM1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 84808 |
| UniProt: | Q5SV97 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PVQEDRPGPGLGLSTPVPVTEQGTDQIRTPRRAKLHTVSTTVWEALPDVSRAKSDMAVSTPASEPQPDRDMAVSTPASEPQSDRDMAVSTPASEPQPD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PERM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human skeletal muscle and pancreas tissues using HPA031712 antibody. Corresponding PERM1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human pancreas shows no positivity as expected. |
|
|
HPA031712-100ul |
|
|
HPA031712-100ul |
|
|
HPA031712-100ul |
Product Guarantee and Expert Support
