Anti-TTBK1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031736
Artikelname: Anti-TTBK1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031736
Hersteller Artikelnummer: HPA031736
Alternativnummer: ATA-HPA031736-100,ATA-HPA031736-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA1855
tau tubulin kinase 1
Anti-TTBK1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 84630
UniProt: Q5TCY1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RLVMEKRQGRLLLRLASGASSSSSEEQRRASETLSGTGSEEDTPASEPAAALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TTBK1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human cerebral cortex and kidney tissues using HPA031736 antibody. Corresponding TTBK1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows low positivity in trophoblastic cells as expected.
Immunohistochemical staining of human lymph node shows low positivity in non-germinal center cells.
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemical staining of human kidney shows low positivity as expected.
HPA031736
HPA031736
HPA031736