Anti-TTBK1
Artikelnummer:
ATA-HPA031736
- Bilder (8)
| Artikelname: | Anti-TTBK1 |
| Artikelnummer: | ATA-HPA031736 |
| Hersteller Artikelnummer: | HPA031736 |
| Alternativnummer: | ATA-HPA031736-100,ATA-HPA031736-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA1855 |
| tau tubulin kinase 1 |
| Anti-TTBK1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 84630 |
| UniProt: | Q5TCY1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RLVMEKRQGRLLLRLASGASSSSSEEQRRASETLSGTGSEEDTPASEPAAALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TTBK1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and kidney tissues using HPA031736 antibody. Corresponding TTBK1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows low positivity in trophoblastic cells as expected. |
|
|
Immunohistochemical staining of human lymph node shows low positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human kidney shows low positivity as expected. |
|
|
HPA031736-100ul |
|
|
HPA031736-100ul |
|
|
HPA031736-100ul |
Produktgarantie und fachkundiger Support
