Anti-TTBK1

Catalog Number: ATA-HPA031736
Article Name: Anti-TTBK1
Biozol Catalog Number: ATA-HPA031736
Supplier Catalog Number: HPA031736
Alternative Catalog Number: ATA-HPA031736-100,ATA-HPA031736-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1855
tau tubulin kinase 1
Anti-TTBK1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 84630
UniProt: Q5TCY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RLVMEKRQGRLLLRLASGASSSSSEEQRRASETLSGTGSEEDTPASEPAAALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TTBK1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human cerebral cortex and kidney tissues using HPA031736 antibody. Corresponding TTBK1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows low positivity in trophoblastic cells as expected.
Immunohistochemical staining of human lymph node shows low positivity in non-germinal center cells.
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemical staining of human kidney shows low positivity as expected.
HPA031736-100ul
HPA031736-100ul
HPA031736-100ul