Anti-TTBK1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA031736
- Images (8)
| Article Name: | Anti-TTBK1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA031736 |
| Supplier Catalog Number: | HPA031736 |
| Alternative Catalog Number: | ATA-HPA031736-100,ATA-HPA031736-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA1855 |
| tau tubulin kinase 1 |
| Anti-TTBK1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 84630 |
| UniProt: | Q5TCY1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RLVMEKRQGRLLLRLASGASSSSSEEQRRASETLSGTGSEEDTPASEPAAALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TTBK1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and kidney tissues using HPA031736 antibody. Corresponding TTBK1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows low positivity in trophoblastic cells as expected. |
|
|
Immunohistochemical staining of human lymph node shows low positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human kidney shows low positivity as expected. |
|
|
HPA031736 |
|
|
HPA031736 |
|
|
HPA031736 |
Product Guarantee and Expert Support
