Anti-COLGALT2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031750
Artikelname: Anti-COLGALT2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031750
Hersteller Artikelnummer: HPA031750
Alternativnummer: ATA-HPA031750-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C1orf17, GLT25D2, KIAA0584
collagen beta(1-O)galactosyltransferase 2
Anti-COLGALT2
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 23127
UniProt: Q8IYK4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PTHYTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSRIYSNAKNTEALPPPTSLDTVPSRDEL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: COLGALT2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human rectum shows strong granular positivity in glandular cells.
Western blot analysis using Anti-COLGALT2 antibody HPA031750 (A) shows similar pattern to independent antibody HPA031749 (B).
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA031750
HPA031750
HPA031750
HPA031750
HPA031750