Anti-COLGALT2
Catalog Number:
ATA-HPA031750
- Images (8)
| Article Name: | Anti-COLGALT2 |
| Biozol Catalog Number: | ATA-HPA031750 |
| Supplier Catalog Number: | HPA031750 |
| Alternative Catalog Number: | ATA-HPA031750-100,ATA-HPA031750-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C1orf17, GLT25D2, KIAA0584 |
| collagen beta(1-O)galactosyltransferase 2 |
| Anti-COLGALT2 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 23127 |
| UniProt: | Q8IYK4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PTHYTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSRIYSNAKNTEALPPPTSLDTVPSRDEL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | COLGALT2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |








