Anti-PLCL1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031849
Artikelname: Anti-PLCL1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031849
Hersteller Artikelnummer: HPA031849
Alternativnummer: ATA-HPA031849-100,ATA-HPA031849-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PLC-L, PLCE, PLCL, PPP1R127, PRIP
phospholipase C-like 1
Anti-PLCL1
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 5334
UniProt: Q15111
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTEEEF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PLCL1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human kidney and lung tissues using HPA031849 antibody. Corresponding PLCL1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.
Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity.
Immunohistochemical staining of human lung shows weak to moderate cytoplasmic positivity in pneumocytes and in macrophages.
HPA031849
HPA031849
HPA031849