Anti-PLCL1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA031849
- Images (8)
| Article Name: | Anti-PLCL1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA031849 |
| Supplier Catalog Number: | HPA031849 |
| Alternative Catalog Number: | ATA-HPA031849-100,ATA-HPA031849-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PLC-L, PLCE, PLCL, PPP1R127, PRIP |
| phospholipase C-like 1 |
| Anti-PLCL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 5334 |
| UniProt: | Q15111 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTEEEF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLCL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human kidney and lung tissues using HPA031849 antibody. Corresponding PLCL1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells. |
|
|
Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity. |
|
|
Immunohistochemical staining of human lung shows weak to moderate cytoplasmic positivity in pneumocytes and in macrophages. |
|
|
HPA031849 |
|
|
HPA031849 |
|
|
HPA031849 |
Product Guarantee and Expert Support
