Anti-COX5B Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA034517
Artikelname: Anti-COX5B Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA034517
Hersteller Artikelnummer: HPA034517
Alternativnummer: ATA-HPA034517-100,ATA-HPA034517-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: COX5B
cytochrome c oxidase subunit Vb
Anti-COX5B
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 1329
UniProt: P10606
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: COX5B
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human stomach shows distinct granular cytoplasmic positivity in glandular cells.
Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-COX5B antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-COX5B antibody. Remaining relative intensity is presented
Western blot analysis in human cell line HEK 293.
HPA034517
HPA034517
HPA034517