Anti-COX5B
Catalog Number:
ATA-HPA034517
- Images (8)
| Article Name: | Anti-COX5B |
| Biozol Catalog Number: | ATA-HPA034517 |
| Supplier Catalog Number: | HPA034517 |
| Alternative Catalog Number: | ATA-HPA034517-100,ATA-HPA034517-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | COX5B |
| cytochrome c oxidase subunit Vb |
| Anti-COX5B |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Isotype: | IgG |
| NCBI: | 1329 |
| UniProt: | P10606 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | COX5B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. |
|
|
Immunohistochemical staining of human stomach shows distinct granular cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-COX5B antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-COX5B antibody. Remaining relative intensity is presented |
|
|
Western blot analysis in human cell line HEK 293. |
|
|
HPA034517-100ul |
|
|
HPA034517-100ul |
|
|
HPA034517-100ul |
Product Guarantee and Expert Support
