Anti-COX5B Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-COX5B Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA034517
• Supplier Catalog Number: HPA034517
• Alternative Catalog Number: ATA-HPA034517-100,ATA-HPA034517-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: COX5B

Product Description

cytochrome c oxidase subunit Vb

Additional Information

Anti-COX5B

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Isotype: IgG
• NCBI: 1329
• UniProt: P10606
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: COX5B
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemical staining of human stomach shows distinct granular cytoplasmic positivity in glandular cells.

Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-COX5B antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-COX5B antibody. Remaining relative intensity is presented

Western blot analysis in human cell line HEK 293.

HPA034517

HPA034517

HPA034517