Anti-PTPRO Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA034525
Artikelname: Anti-PTPRO Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA034525
Hersteller Artikelnummer: HPA034525
Alternativnummer: ATA-HPA034525-100,ATA-HPA034525-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GLEPP1, NPHS6, PTP-oc, PTP-U2, PTPU2
protein tyrosine phosphatase, receptor type, O
Anti-PTPRO
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 5800
UniProt: Q16827
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PTPRO
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA034525 antibody. Corresponding PTPRO RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli.
Immunohistochemical staining of human cerebral cortex shows very weak cytoplasmic positivity in neuronal cells.
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA034525
HPA034525
HPA034525