Anti-PTPRO

Catalog Number: ATA-HPA034525
Article Name: Anti-PTPRO
Biozol Catalog Number: ATA-HPA034525
Supplier Catalog Number: HPA034525
Alternative Catalog Number: ATA-HPA034525-100,ATA-HPA034525-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GLEPP1, NPHS6, PTP-oc, PTP-U2, PTPU2
protein tyrosine phosphatase, receptor type, O
Anti-PTPRO
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 5800
UniProt: Q16827
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PTPRO
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA034525 antibody. Corresponding PTPRO RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli.
Immunohistochemical staining of human cerebral cortex shows very weak cytoplasmic positivity in neuronal cells.
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA034525
HPA034525
HPA034525