Anti-PTPRO Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA034525
- Images (8)
| Article Name: | Anti-PTPRO Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA034525 |
| Supplier Catalog Number: | HPA034525 |
| Alternative Catalog Number: | ATA-HPA034525-100,ATA-HPA034525-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | GLEPP1, NPHS6, PTP-oc, PTP-U2, PTPU2 |
| protein tyrosine phosphatase, receptor type, O |
| Anti-PTPRO |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5800 |
| UniProt: | Q16827 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PTPRO |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA034525 antibody. Corresponding PTPRO RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human cerebral cortex shows very weak cytoplasmic positivity in neuronal cells. |
|
|
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA034525 |
|
|
HPA034525 |
|
|
HPA034525 |
Product Guarantee and Expert Support
