Anti-SNRNP27

Artikelnummer: ATA-HPA034541
Artikelname: Anti-SNRNP27
Artikelnummer: ATA-HPA034541
Hersteller Artikelnummer: HPA034541
Alternativnummer: ATA-HPA034541-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: RY1
small nuclear ribonucleoprotein 27kDa (U4/U6.U5)
Anti-SNRNP27
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 11017
UniProt: Q8WVK2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TSPSPSRLKERRDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SNRNP27
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human gall bladder shows strong nuclear and cytoplasmic positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and SNRNP27 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416350).
HPA034541-100ul
HPA034541-100ul
HPA034541-100ul