Anti-SNRNP27

Catalog Number: ATA-HPA034541
Article Name: Anti-SNRNP27
Biozol Catalog Number: ATA-HPA034541
Supplier Catalog Number: HPA034541
Alternative Catalog Number: ATA-HPA034541-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RY1
small nuclear ribonucleoprotein 27kDa (U4/U6.U5)
Anti-SNRNP27
Clonality: Polyclonal
Isotype: IgG
NCBI: 11017
UniProt: Q8WVK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TSPSPSRLKERRDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SNRNP27
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human gall bladder shows strong nuclear and cytoplasmic positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and SNRNP27 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416350).
HPA034541
HPA034541
HPA034541