Anti-SCGB2A1

Artikelnummer: ATA-HPA034584
Artikelname: Anti-SCGB2A1
Artikelnummer: ATA-HPA034584
Hersteller Artikelnummer: HPA034584
Alternativnummer: ATA-HPA034584-100,ATA-HPA034584-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: LPHC, MGB2, MGC71973, UGB3
secretoglobin, family 2A, member 1
Anti-SCGB2A1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 4246
UniProt: O75556
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SCGB2A1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cervix, uterine and testis tissues using Anti-SCGB2A1 antibody. Corresponding SCGB2A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cervix, uterine shows high expression.
Immunohistochemical staining of human testis shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and SCGB2A1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400860).
HPA034584-100ul
HPA034584-100ul
HPA034584-100ul