Anti-SCGB2A1

Catalog Number: ATA-HPA034584
Article Name: Anti-SCGB2A1
Biozol Catalog Number: ATA-HPA034584
Supplier Catalog Number: HPA034584
Alternative Catalog Number: ATA-HPA034584-100,ATA-HPA034584-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LPHC, MGB2, MGC71973, UGB3
secretoglobin, family 2A, member 1
Anti-SCGB2A1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 4246
UniProt: O75556
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SCGB2A1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cervix, uterine and testis tissues using Anti-SCGB2A1 antibody. Corresponding SCGB2A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cervix, uterine shows high expression.
Immunohistochemical staining of human testis shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and SCGB2A1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400860).
HPA034584-100ul
HPA034584-100ul
HPA034584-100ul