Anti-NCKAP5

Artikelnummer: ATA-HPA034639
Artikelname: Anti-NCKAP5
Artikelnummer: ATA-HPA034639
Hersteller Artikelnummer: HPA034639
Alternativnummer: ATA-HPA034639-100,ATA-HPA034639-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ERIH1, ERIH2, NAP5
NCK-associated protein 5
Anti-NCKAP5
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 344148
UniProt: O14513
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SKLTHSVSDSLFGWETNRKHFLEGTSSVYPKERPEKLTSCASSCPLEMKLCPSVQTPQVQRERGPQGQGHGRMALNLQLSD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NCKAP5
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
HPA034639-100ul