Anti-NCKAP5

Catalog Number: ATA-HPA034639
Article Name: Anti-NCKAP5
Biozol Catalog Number: ATA-HPA034639
Supplier Catalog Number: HPA034639
Alternative Catalog Number: ATA-HPA034639-100,ATA-HPA034639-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ERIH1, ERIH2, NAP5
NCK-associated protein 5
Anti-NCKAP5
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 344148
UniProt: O14513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SKLTHSVSDSLFGWETNRKHFLEGTSSVYPKERPEKLTSCASSCPLEMKLCPSVQTPQVQRERGPQGQGHGRMALNLQLSD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NCKAP5
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
HPA034639-100ul