Anti-KIF4A

Artikelnummer: ATA-HPA034745
Artikelname: Anti-KIF4A
Artikelnummer: ATA-HPA034745
Hersteller Artikelnummer: HPA034745
Alternativnummer: ATA-HPA034745-100,ATA-HPA034745-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ12530, FLJ12655, FLJ14204, FLJ20631, HSA271784, KIF4, KIF4-G1, MRX100
kinesin family member 4A
Anti-KIF4A
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 24137
UniProt: O95239
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIEDLKYCSEHSVNEHEDGDGDDDEGDDEEWKPTKL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: KIF4A
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA034745-100ul
HPA034745-100ul
HPA034745-100ul