Anti-KIF4A

Catalog Number: ATA-HPA034745
Article Name: Anti-KIF4A
Biozol Catalog Number: ATA-HPA034745
Supplier Catalog Number: HPA034745
Alternative Catalog Number: ATA-HPA034745-100,ATA-HPA034745-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ12530, FLJ12655, FLJ14204, FLJ20631, HSA271784, KIF4, KIF4-G1, MRX100
kinesin family member 4A
Anti-KIF4A
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 24137
UniProt: O95239
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPSRVKEKFLEQSMDIEDLKYCSEHSVNEHEDGDGDDDEGDDEEWKPTKL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: KIF4A
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA034745-100ul
HPA034745-100ul
HPA034745-100ul