Anti-VCAM1
Artikelnummer:
ATA-HPA034796
- Bilder (9)
| Artikelname: | Anti-VCAM1 |
| Artikelnummer: | ATA-HPA034796 |
| Hersteller Artikelnummer: | HPA034796 |
| Alternativnummer: | ATA-HPA034796-100,ATA-HPA034796-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD106 |
| vascular cell adhesion molecule 1 |
| Anti-VCAM1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7412 |
| UniProt: | P19320 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | IGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | VCAM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human spleen and skeletal muscle tissues using HPA034796 antibody. Corresponding VCAM1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells or in islets of Langerhans. |
|
|
Immunohistochemical staining of human tonsil shows moderate membranous positivity in germinal center cells. |
|
|
Immunohistochemical staining of human Fallopian tube shows no positivity in glandular cells. |
|
|
Immunohistochemical staining of human spleen shows strong membranous positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes. |
|
|
HPA034796-100ul |
|
|
HPA034796-100ul |
|
|
HPA034796-100ul |
Produktgarantie und fachkundiger Support
