Anti-VCAM1
Catalog Number:
ATA-HPA034796
- Images (9)
| Article Name: | Anti-VCAM1 |
| Biozol Catalog Number: | ATA-HPA034796 |
| Supplier Catalog Number: | HPA034796 |
| Alternative Catalog Number: | ATA-HPA034796-100,ATA-HPA034796-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD106 |
| vascular cell adhesion molecule 1 |
| Anti-VCAM1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 7412 |
| UniProt: | P19320 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | IGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | VCAM1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human spleen and skeletal muscle tissues using HPA034796 antibody. Corresponding VCAM1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells or in islets of Langerhans. |
|
|
Immunohistochemical staining of human tonsil shows moderate membranous positivity in germinal center cells. |
|
|
Immunohistochemical staining of human Fallopian tube shows no positivity in glandular cells. |
|
|
Immunohistochemical staining of human spleen shows strong membranous positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes. |
|
|
HPA034796-100ul |
|
|
HPA034796-100ul |
|
|
HPA034796-100ul |
Product Guarantee and Expert Support
