Anti-SF3B6
Artikelnummer:
ATA-HPA034830
- Bilder (9)
| Artikelname: | Anti-SF3B6 |
| Artikelnummer: | ATA-HPA034830 |
| Hersteller Artikelnummer: | HPA034830 |
| Alternativnummer: | ATA-HPA034830-100,ATA-HPA034830-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CGI-110, Ht006, P14, SAP14a, SF3B14a |
| splicing factor 3b, subunit 6, 14kDa |
| Anti-SF3B6 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51639 |
| UniProt: | Q9Y3B4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SF3B6 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human breast and skeletal muscle tissues using Anti-SF3B6 antibody. Corresponding SF3B6 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human breast, kidney, lymph node and skeletal muscle using Anti-SF3B6 antibody HPA034830 (A) shows similar protein distribution across tissues to independent antibody HPA034829 (B). |
|
|
Immunohistochemical staining of human breast shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human kidney using Anti-SF3B6 antibody HPA034830. |
|
|
Immunohistochemical staining of human lymph node using Anti-SF3B6 antibody HPA034830. |
|
|
HPA034830-100ul |
|
|
HPA034830-100ul |
|
|
HPA034830-100ul |
Produktgarantie und fachkundiger Support
